Skip to main content

Table 7 Linear epitopes of MCH and MCH-LR5 predicted by Ellipro and confirmed by vaxijen

From: Designing a chimeric subunit vaccine for influenza virus, based on HA2, M2e and CTxB: a bioinformatics study

Vaccine No Start End Sequence Length Score
MCH 1 202 247 LNRLIAKTNOQFELIDNEFNEVEKOIGNVINVVTROSITEVWSYNAE 46 0.829
2 68 103 DKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQH 36 0.741
MCH-LR5 No epitope confirmed by VaxiJen for vaccine containing linker. For details of predicted linear epitopes please see Table S9.